PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G01120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 270aa    MW: 30851 Da    PI: 5.1135
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G01120genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.5e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +l++ +   G  +W+++++  g+ R++k+c++rw +yl
       AA53G01120 14 KGPWTAEEDRKLINFILTNGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                     79******************************99************97 PP

2Myb_DNA-binding50.93.5e-1673111747
                      HHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   7 eEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       E++  +d+++qlG++ W++Ia++++ gRt++++k++w+++
       AA53G01120  73 YEEKMVIDLHAQLGNR-WSKIASHLP-GRTDNEIKNHWNTH 111
                      599*************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-20562IPR009057Homeodomain-like
PROSITE profilePS5129414.177961IPR017930Myb domain
SuperFamilySSF466891.44E-2611108IPR009057Homeodomain-like
SMARTSM007171.7E-121363IPR001005SANT/Myb domain
PfamPF002494.4E-141461IPR001005SANT/Myb domain
CDDcd001672.67E-81661No hitNo description
PROSITE profilePS5129425.21562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.0E-2463117IPR009057Homeodomain-like
SMARTSM007179.9E-1466114IPR001005SANT/Myb domain
PfamPF002498.0E-1473111IPR001005SANT/Myb domain
CDDcd001673.73E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 270 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAE EDRKLINFIL TNGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDYEEKMVID LHAQLGNRWS KIASHLPGRT DNEIKNHWNT HIKKKLKKMG  120
IDPVTHKPLE SKRIDQEQEK YEKVEKTEQS TRNVSVCMDY GVEEVPLIEP ECLEVICSDS  180
VMHSSSSTTT TTSTMSSGSC NESSFLKDLE FLEFDWSGLD CGNDKSDEIG VEKNIIENDM  240
MSLWDVDDFS NWDLLLNDDI PQSLCTFGFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006391368.11e-124hypothetical protein EUTSA_v10019852mg
SwissprotQ50EX62e-86ODO1_PETHY; Protein ODORANT1
TrEMBLV4KC291e-124V4KC29_EUTSA; Uncharacterized protein
STRINGBra004155.1-P1e-120(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.11e-114myb domain protein 20